Cat#:RPH-NP181;Product Name:Recombinant Human HGPRT / HPRT1 Protein;Synonym:Hypoxanthine-Guanine Phosphoribosyltransferase, HGPRT, HGPRTase, HPRT1, HPRT;Description:Recombinant Human HGPRT Protein is produced in E.coli and the target gene encoding Met1-Ala218 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMATRSPGVVISDDEPGYDLDLFCIPNHYAEDLERVFIPHGLIMDR TERLARDVMKEMGGHHIVALCVLKGGYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQS TGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVRQYNPKMVKVASLLVKRTPRSVGYK PDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKAVEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human HGPRT/HPRT1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 250mM NaCl, 2mM EDTA, 30% Glycerol, pH 8.0.;Stability:Recombinant Human HGPRT/HPRT1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human HGPRT/HPRT1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;