Cat#:RPH-NP180;Product Name:Recombinant Human Hexokinase-3 / HK3 Protein;Synonym:Hexokinase-3, Hexokinase type III, HKIII and HK3.;Description:Recombinant Human Hexokinase-3 Protein is produced in E.coli and the target gene encoding Met1-Val923 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MDSIGSSGLRQGEETLSCSEEGLPGPSDSSELVQECLQQFKVTRAQLQQIQASLLGSMEQALRGQ ASPAPAVRMLPTYVGSTPHGTEQGDFVVLELGATGASLRVLWVTLTGIEGHRVEPRSQEFVIPQE VMLGAGQQLFDFAAHCLSEFLDAQPVNKQGLQLGFSFSFPCHQTGLDRSTLISWTKGFRCSGVEG QDVVQLLRDAIRRQGAYNIDVVAVVNDTVGTMMGCEPGVRPCEVGLVVDTGTNACYMEEARHVAV LDEDRGRVCVSVEWGSFSDDGALGPVLTTFDHTLDHESLNPGAQRFEKMIGGLYLGELVRLVLAH LARCGVLFGGCTSPALLSQGSILLEHVAEMEDPSTGAARVHAILQDLGLSPGASDVELVQHVCAA VCTRAAQLCAAALAAVLSCLQHSREQQTLQVAVATGGRVCERHPRFCSVLQGTVMLLAPECDVSL IPSVDGGGRGVAMVTAVAARLAAHRRLLEETLAPFRLNHDQLAAVQAQMRKAMAKGLRGEASSLR MLPTFVRATPDGSERGDFLALDLGGTNFRVLLVRVTTGVQITSEIYSIPETVAQGSGQQLFDHIV DCIVDFQQKQGLSGQSLPLGFTFSFPCRQLGLDQGILLNWTKGFKASDCEGQDVVSLLREAITRR QAVELNVVAIVNDTVGTMMSCGYEDPRCEIGLIVGTGTNACYMEELRNVAGVPGDSGRMCINMEW GAFGDDGSLAMLSTRFDASVDQASINPGKQRFEKMISGMYLGEIVRHILLHLTSLGVLFRGQQIQ RLQTRDIFKTKFLSEIESDSLALRQVRAILEDLGLPLTSDDALMVLEVCQAVSQRAAQLCGAGVA AVVEKIRENRGLEELAVSVGVDGTLYKLHPRFSSLVAATVRELAPRCVVTFLQSEDGSGKGAALV TAVACRLAQLTRVLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Hexokinase-3/HK3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Hexokinase-3/HK3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Hexokinase-3/HK3 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted Recombinant Human HK3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted Recombinant Human HK3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Hexokinase-3/HK3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Hexokinase-3/HK3 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Hexokinase-3/HK3 Protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted Recombinant Human HK3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted Recombinant Human HK3 protein samples are stable below -20°C for 3 months.