Cat#:RPH-NP179;Product Name:Recombinant Human Hepatoma-Derived Growth Factor / HDGF Protein;Synonym:Hepatoma-Derived Growth Factor, HDGF, High Mobility Group Protein 1-Kike 2, HMG-1L2, HDGF, HMG1L2;Description:Recombinant Human Hepatoma-Derived Growth Factor Protein is produced in E.coli and the target gene encoding Met1-Tyr100 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFP YEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Hepatoma-Derived Growth Factor/HDGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 1mM EDTA, pH 7.5.;Stability:Recombinant Human Hepatoma-Derived Growth Factor/HDGF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human HDGF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human HDGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human HDGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Hepatoma-Derived Growth Factor / HDGF Protein
Online Inquiry
Cat#:
RPH-NP179
Product Name:
Recombinant Human Hepatoma-Derived Growth Factor / HDGF Protein
Synonym:
Hepatoma-Derived Growth Factor, HDGF, High Mobility Group Protein 1-Kike 2, HMG-1L2, HDGF, HMG1L2
Description:
Recombinant Human Hepatoma-Derived Growth Factor Protein is produced in E.coli and the target gene encoding Met1-Tyr100 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Hepatoma-Derived Growth Factor/HDGF Protein was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 1mM EDTA, pH 7.5.
Stability:
Recombinant Human Hepatoma-Derived Growth Factor/HDGF Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human HDGF protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant human HDGF protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human HDGF protein samples are stable below -20°C for 3 months.