Cat#:RPH-NP183;Product Name:Recombinant Human Hyaluronidase-1 / HYAL1 Protein;Synonym:Hyaluronidase-1, Hyal-1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1, LuCa-1, HYAL1, LUCA1;Description:Recombinant Human Hyaluronidase-1 Protein is produced in Human Cells and the target gene encoding Phe22-Trp435 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:FRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVANPGQTFRGPDMTIFYSSQLGTYPYYT PTGEPVFGGLPQNASLIAHLARTFQDILAAIPAPDFSGLAVIDWEAWRPRWAFNWDTKDIYRQRS RALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPN YTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNL PVLPYVQIFYDTTNHFLPLDELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGP FILNVTSGALLCSQALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQ MAVEFKCRCYPGWQAPWCERKSMWVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Hyaluronidase-1/HYAL1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 10%Glycerol, pH7.5.;Stability:Recombinant Human Hyaluronidase-1/HYAL1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Hyaluronidase-1/HYAL1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Hyaluronidase-1 / HYAL1 Protein
Online Inquiry
Cat#:
RPH-NP183
Product Name:
Recombinant Human Hyaluronidase-1 / HYAL1 Protein
Synonym:
Hyaluronidase-1, Hyal-1, Hyaluronoglucosaminidase-1, Lung Carcinoma Protein 1, LuCa-1, HYAL1, LUCA1
Description:
Recombinant Human Hyaluronidase-1 Protein is produced in Human Cells and the target gene encoding Phe22-Trp435 is expressed with a His tag at the C-terminus.