Cat#:RPH-NP162;Product Name:Recombinant Human Glutamate Oxaloacetate Transaminase 1 / GOT1 Protein;Synonym:Aspartate Aminotransferase Cytoplasmic, Glutamate Oxaloacetate Transaminase 1, Transaminase A, GOT1;Description:Recombinant Human Glutamate Oxaloacetate Transaminase 1 Protein is produced in E.coli and the target gene encoding Ala2-Leu414 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:APPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQKIANDNS LNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFLARWYNGTNNKN TPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNP TGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQSFSKNF GLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKT MADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVS GLTTKNLDYVATSIHEAVTKIQLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 20% Glycerol, pH 7.5 .;Stability:Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Glutamate Oxaloacetate Transaminase 1 / GOT1 Protein
Online Inquiry
Cat#:
RPH-NP162
Product Name:
Recombinant Human Glutamate Oxaloacetate Transaminase 1 / GOT1 Protein
Synonym:
Aspartate Aminotransferase Cytoplasmic, Glutamate Oxaloacetate Transaminase 1, Transaminase A, GOT1
Description:
Recombinant Human Glutamate Oxaloacetate Transaminase 1 Protein is produced in E.coli and the target gene encoding Ala2-Leu414 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 2mM DTT, 20% Glycerol, pH 7.5 .
Stability:
Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Glutamate Oxaloacetate Transaminase 1/GOT1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.