Cat#:RPH-NP163;Product Name:Recombinant Human Glutamine Synthetase / GLUL Protein;Synonym:Glutamine Synthetase, GS, Glutamate Decarboxylase, Glutamate--Ammonia Ligase, GLUL, GLNS;Description:Recombinant Human Glutamine Synthetase Protein is produced in E.coli and the target gene encoding Thr2-Asn373 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:TTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSS TLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWF GMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAE VMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAM REENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIP RTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKNLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glutamine Synthetase/GLUL Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, 50mM Imidazole, pH 8.0.;Stability:Recombinant Human Glutamine Synthetase/GLUL Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glutamine Synthetase/GLUL Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Glutamine Synthetase Protein is produced in E.coli and the target gene encoding Thr2-Asn373 is expressed with a His tag at the C-terminus.