Cat#:RPH-NP164;Product Name:Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial / GCDH Protein;Synonym:Glutaryl-CoA Dehydrogenase Mitochondrial, GCD, GCDH;Description:Recombinant Human GCDH Protein is produced in E.coli and the target gene encoding Arg45-Lys438 is expressed with a His tag at the N-terminus.;Source:E. coli;AA Sequence:MNHKVHHHHHHMRPEFDWQDPLVLEEQLTTDEILIRDTFRTYCQERLMPRILLANRNEVFHREII SEMGELGVLGPTIKGYGCAGVSSVAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQ KYLPQLAKGELLGCFGLTEPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWAR CEDGCIRGFLLEKGMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNN ARYGIAWGVLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLK DQDKAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIHAL ILGRAITGIQAFTASK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein was supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH 7.4.;Stability:Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein was supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, pH 7.4.
Stability:
Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Glutaryl-CoA Dehydrogenase Mitochondrial/GCDH Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.