Cat#:RPH-NP165;Product Name:Recombinant Human Glutathione Synthetase / GSH Synthetase Protein;Synonym:Glutathione Synthetase, GSH Synthetase, GSH-S, Glutathione Synthase, GSS;Description:Recombinant Human GSH Synthetase Protein is produced in E.coli and the target gene encoding Ala2-Val474 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:ATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSALLEQAY AVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVFLGLNRSDYMFQ RSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKILSNNPSKGLALGIAKAW ELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFEDISEKGSLDQDRRLFVDGQEI AVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQLAGTKKVQQELSRPGMLEMLLPGQPE AVARLRATFAGLYSLDVGEEGDQAIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEE RASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEH ADGGVAAGVAVLDNPYPVLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glutathione Synthetase/GSH Synthetase Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, pH 7.5 .;Stability:Recombinant Human Glutathione Synthetase/GSH Synthetase Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glutathione Synthetase/GSH Synthetase Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Glutathione Synthetase/GSH Synthetase Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 200mM NaCl, pH 7.5 .
Stability:
Recombinant Human Glutathione Synthetase/GSH Synthetase Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Glutathione Synthetase/GSH Synthetase Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.