Cat#:RPH-NP161;Product Name:Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase / G6PD Protein;Synonym:Glucose-6-Phosphate 1-Dehydrogenase, G6PD;Description:Recombinant Human G6PD Protein is produced in Human Cells and the target gene encoding Ala2-Leu515 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:AEQVALSRTQVCGILREELFQGDAFHQSDTHIFIIMGASGDLAKKKIYPTIWWLFRDGLLPENTF IVGYARSRLTVADIRKQSEPFFKATPEEKLKLEDFFARNSYVAGQYDDAASYQRLNSHMNALHLG SQANRLFYLALPPTVYEAVTKNIHESCMSQIGWNRIIVEKPFGRDLQSSDRLSNHISSLFREDQI YRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEPFGTEGRGGYFDEFGIIRDVMQ NHLLQMLCLVAMEKPASTNSDDVRDEKVKVLKCISEVQANNVVLGQYVGNPDGEGEATKGYLDDP TVPRGSTTATFAAVVLYVENERWDGVPFILRCGKALNERKAEVRLQFHDVAGDIFHQQCKRNELV IRVQPNEAVYTKMMTKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSD ELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKLVDHHHH HH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein was supplied as a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein was supplied as a 0.2 μm filtered solution of PBS, pH7.4.
Stability:
Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Glucose-6-Phosphate 1-Dehydrogenase/G6PD Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.