Cat#:RPH-NP160;Product Name:Recombinant Human Glucagon / GCG Protein;Synonym:Glucagon, Glicentin, Glicentin-Related Polypeptide, GRPP, Oxyntomodulin, OXM, OXY, Glucagon, Glucagon-Like Peptide 1, GLP-1, Incretin Hormone, Glucagon-like Peptide 1, GLP-1, Glucagon-Like Peptide 2, GLP-2, GCG;Description:Recombinant Human Glucagon Protein is produced in Human Cells and the target gene encoding Arg21-Lys180 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:RSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNR NNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGS FSDEMNTILDNLAARDFINWLIQTKITDRK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Glucagon/GCG Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,200mM NaCl,1mM DTT,50% Glycerol,pH 8.0.;Stability:Recombinant Human Glucagon/GCG Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Glucagon/GCG Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;