Cat#:RPH-NP153;Product Name:Recombinant Human GDNF Family Receptor α-1 / GFRA1 Protein;Synonym:GDNF Family Receptor Alpha-1, GDNF Receptor Alpha-1, GDNFR-Alpha-1, GFR-Alpha-1, RET Ligand 1, TGF-Beta-Related Neurotrophic Factor Receptor 1, GFRA1, GDNFRA, RETL1, TRNR1;Description:Recombinant Human GDNF Family Receptor alpha-1 Protein is produced in Human Cells and the target gene encoding Asp25-Lys429 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DRLDCVKASDQCLKEQSCSTKYRTLRQCVAGKETNFSLASGLEAKDECRSAMEALKQKSLYNCRC KRGMKKEKNCLRIYWSMYQSLQGNDLLEDSPYEPVNSRLSDIFRVVPFISVEHIPKGNNCLDAAK ACNLDDICKKYRSAYITPCTTSVSNDVCNRRKCHKALRQFFDKVPAKHSYGMLFCSCRDIACTER RRQTIVPVCSYEEREKPNCLNLQDSCKTNYICRSRLADFFTNCQPESRSVSSCLKENYADCLLAY SGLIGTVMTPNYIDSSSLSVAPWCDCSNSGNDLEECLKFLNFFKDNTCLKNAIQAFGNGSDVTVW QPAFPVQTTTATTTTALRVKNKPLGPAGSENEIPTHVLPPCANLQAQKLKSNVSGNTHLCISNGN YEKEGLGASSHITTKVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human GDNF Family Receptor alpha-1 Protein is produced in Human Cells and the target gene encoding Asp25-Lys429 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human GDNF Family Receptor α-1/GFRA1 Protein samples are stable below -20°C for 3 months.