Cat#:RPH-NP152;Product Name:Recombinant Human Gastric Triacylglycerol Lipase / LIPF Protein;Synonym:Gastric Triacylglycerol Lipase, GL, Gastric Lipase, LIPF;Description:Recombinant Human Gastric Triacylglycerol Lipase Protein is produced in Human Cells and the target gene encoding Leu20-Lys398 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH GLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYD LPATIDFIVKKAGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKL RFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYL SHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDL LADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKKVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein was supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 100mM glycine, 10%glycerol,pH 7.3.;Stability:Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Gastric Triacylglycerol Lipase Protein is produced in Human Cells and the target gene encoding Leu20-Lys398 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein was supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 100mM glycine, 10%glycerol,pH 7.3.
Stability:
Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Gastric Triacylglycerol Lipase/LIPF Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.