Cat#:RPH-NP154;Product Name:Recombinant Human GDNF Receptor α-2 / GFRA2 Protein;Synonym:GDNF Family Receptor Alpha-2, GDNF Receptor Alpha-2, GDNFR-Alpha-2, GFR-Alpha-2, GDNF Receptor Beta, GDNFR-Beta, Neurturin Receptor Alpha, NRTNR-Alpha, NTNR-Alpha, RET Ligand 2, TGF-Beta-Related Neurotrophic Factor Receptor 2, GFRA2, GDNFRB, RETL2, TRNR2;Description:Recombinant Human GDNF Family Receptor alpha-2 Protein is produced in Human Cells and the target gene encoding Ser22-Ser441 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:SPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQAALEVLQ ESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGAD PVVSAKSNHCLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYT YRMLFCSCQDQACAERRRQTILPSCSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQT VTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVSPWCSCRGSGNMEEECEKFLRDFTENP CLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK ANNSKELSMCFTELTTNIIPGSNKVIKPNSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human GDNF Receptor α-2/GFRA2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human GDNF Receptor α-2/GFRA2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human GDNF Receptor α-2/GFRA2 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human GDNF Receptor α-2/GFRA2 Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human GDNF Receptor α-2/GFRA2 Protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;