Cat#:RPH-NP106;Product Name:Recombinant Human Dickkopf-Related Protein 2 / DKK2 Protein(N-Fc, C-His);Synonym:Dickkopf-related protein 2, Dickkopf-2, Dkk-2, hDkk-2;Description:Recombinant Human Dickkopf-related protein 2 Protein is produced in Human Cells and the target gene encoding Asp251-Ile526 is expressed with a Fc tag at the N-terminus, His tag at the C-terminus.;Source:Human Cells;AA Sequence:EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKVDGGGSGGGSGGGSRKRRMAALMRSKDS SCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQA YPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIP ALDGTQHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICK PVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKIVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Dickkopf-Related Protein 2/DKK2 Protein (N-Fc, C-His)was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.;Stability:Recombinant Human Dickkopf-Related Protein 2/DKK2 Protein (N-Fc, C-His)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human DKK2 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human DKK2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human DKK2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Dickkopf-Related Protein 2 / DKK2 Protein(N-Fc, C-His)
Online Inquiry
Cat#:
RPH-NP106
Product Name:
Recombinant Human Dickkopf-Related Protein 2 / DKK2 Protein(N-Fc, C-His)
Synonym:
Dickkopf-related protein 2, Dickkopf-2, Dkk-2, hDkk-2
Description:
Recombinant Human Dickkopf-related protein 2 Protein is produced in Human Cells and the target gene encoding Asp251-Ile526 is expressed with a Fc tag at the N-terminus, His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Dickkopf-Related Protein 2/DKK2 Protein (N-Fc, C-His)was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.
Stability:
Recombinant Human Dickkopf-Related Protein 2/DKK2 Protein (N-Fc, C-His)is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human DKK2 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human DKK2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human DKK2 protein samples are stable below -20°C for 3 months.