Cat#:RPH-NP105;Product Name:Recombinant Human Cytotoxic T-Lymphocyte Protein 4 / CTLA-4 / CD152 Protein;Synonym:Cytotoxic T-lymphocyte protein 4, Cytotoxic T-lymphocyte-associated antigen 4, CTLA-4, CD152, CTLA4;Description:Recombinant Human Cytotoxic T-lymphocyte protein 4 Protein is produced in Human Cells and the target gene encoding Lys36-Asp161 is expressed fused with a His tag at the C-terminus.;Source:Human cells;AA Sequence:KAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDD SICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDHHHH HH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.;Stability:Recombinant Human Cytotoxic T-Lymphocyte Protein 4/CTLA-4/CD152 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CTLA-4 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted human CD152 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CTLA-4 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;