Cat#:RPH-NP107;Product Name:Recombinant Human Dickkopf-Related Protein 3 / DKK3 Protein;Synonym:Dickkopf-Related Protein 3, Dickkopf-3, Dkk-3, hDkk-3, DKK3, REIC;Description:Recombinant Human Dickkopf-Related Protein 3 Protein is produced in Human Cells and the target gene encoding Ala22-Ile350 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVN LANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDE DCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMATRGSNGTICDNQRDCQP GLCCAFQRGLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPHSHSLV YVCKPTFVGSRDQDGEILLPREVPDEYEVGSFMEEVRQELEDLERSLTEEMALGEPAAAAAALLG GEEIVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Dickkopf-Related Protein 3/DKK3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human Dickkopf-Related Protein 3/DKK3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human DKK3 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human DKK3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human DKK3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Dickkopf-Related Protein 3 / DKK3 Protein
Online Inquiry
Cat#:
RPH-NP107
Product Name:
Recombinant Human Dickkopf-Related Protein 3 / DKK3 Protein
Synonym:
Dickkopf-Related Protein 3, Dickkopf-3, Dkk-3, hDkk-3, DKK3, REIC
Description:
Recombinant Human Dickkopf-Related Protein 3 Protein is produced in Human Cells and the target gene encoding Ala22-Ile350 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Dickkopf-Related Protein 3/DKK3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human Dickkopf-Related Protein 3/DKK3 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human DKK3 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human DKK3 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted human DKK3 protein samples are stable below -20°C for 3 months.