• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human C-X-C Motif Chemokine 12 / CXCL12 / SDF-1 Protein(19-93) Online Inquiry

  • Cat#:
  • RPH-NP091
  • Product Name:
  • Recombinant Human C-X-C Motif Chemokine 12 / CXCL12 / SDF-1 Protein(19-93)
  • Synonym:
  • Stromal Cell-Derived Factor 1, SDF-1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-Stimulating Factor, PBSF, CXCL12, SDF1, SDF1A, SDF1B
  • Description:
  • Recombinant Human C-X-C Motif Chemokine 12 Protein is produced in E.coli and the target gene encoding Ser19-Met93 is expressed.
  • Source:
  • E. coli
  • AA Sequence:
  • SDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYL EKALNKRFKM
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (19-93)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
  • Stability:
  • Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (19-93)is stable for up to 1 year from date of receipt at -70℃.
  • Reconstitution:
  • Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Lyophilized recombinant human CXCL12 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CXCL12 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CXCL12 protein samples are stable below -20°C for 3 months.
  • Pre product:Recombinant Human CXCL11 Protein I Advanced Biomart
  • Online Inquiry

    refresh