Cat#:RPH-NP090;Product Name:Recombinant Human C-X-C Motif Chemokine 11 / CXCL11 Protein;Synonym:C-X-C Motif Chemokine 11, Beta-R1, H174, Interferon Gamma-Inducible Protein 9, IP-9, Interferon-Inducible T-Cell Alpha Chemoattractant, I-TAC, Small-Inducible Cytokine B11, CXCL11, ITAC, SCYB11, SCYB9B;Description:Recombinant Human C-X-C Motif Chemokine 11 Protein is produced in E.coli and the target gene encoding Phe22-Phe94 is expressed.;Source:E. coli;AA Sequence:MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLI IKKVERKNF;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-X-C Motif Chemokine 11/CXCL11 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 2.5mM EDTA, 500mM NaCl, pH 9.0.;Stability:Recombinant Human C-X-C Motif Chemokine 11/CXCL11 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL11 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CXCL11 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CXCL11 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;