Cat#:RPH-NP093;Product Name:Recombinant Human C-X-C Motif Chemokine 12 / CXCL12 / SDF-1 Protein(22-89);Synonym:Stromal Cell-Derived Factor 1, SDF-1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-Stimulating Factor, PBSF, CXCL12, SDF1, SDF1A, SDF1B;Description:Recombinant Human C-X-C Motif Chemokine 12 Protein is produced in E.coli and the target gene encoding Lys22-Lys89 is expressed.;Source:E.coli;AA Sequence:KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKA LNK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (22-89)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (22-89)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CXCL12 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CXCL12 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CXCL12 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (22-89)was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Stability:
Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1 Protein (22-89)is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CXCL12 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CXCL12 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CXCL12 protein samples are stable below -20°C for 3 months.