Cat#:RPH-NP084;Product Name:Recombinant Human Connective Tissue Growth Factor / CTGF / CCN2 Protein;Synonym:Connective tissue growth factor, CCN family member 2, Hypertrophic chondrocyte-specific protein 24, Insulin-like growth factor-binding protein 8, IBP-8, IGF-binding protein 8, IGFBP-8;Description:Recombinant Human CTGF Protein is produced in Human Cells and the target gene encoding Glu27-Ala180 is expressed.;Source:Human Cells;AA Sequence:QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRK IGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL PGKCCEEWVCDEPKDQTVVGPALA;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CTGF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human CTGF protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human CTGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Connective Tissue Growth Factor / CTGF / CCN2 Protein
Online Inquiry
Cat#:
RPH-NP084
Product Name:
Recombinant Human Connective Tissue Growth Factor / CTGF / CCN2 Protein
Synonym:
Connective tissue growth factor, CCN family member 2, Hypertrophic chondrocyte-specific protein 24, Insulin-like growth factor-binding protein 8, IBP-8, IGF-binding protein 8, IGFBP-8
Description:
Recombinant Human CTGF Protein is produced in Human Cells and the target gene encoding Glu27-Ala180 is expressed.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Stability:
Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CTGF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human CTGF protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human CTGF protein samples are stable below -20°C for 3 months.