Cat#:RPH-NP083;Product Name:Recombinant Human Connective Tissue Growth Factor / CTGF / CCN2 Protein;Synonym:Connective tissue growth factor,CCN family member 2,Hypertrophic chondrocyte-specific protein 24,Insulin-like growth factor-binding protein 8,CTGF,IGFBP8;Description:Recombinant Human CTGF Protein is produced in Human Cells and the target gene encoding Gln27-Ala349 is expressed with a Fc tag at the C-terminus.;Source:Human Cells;AA Sequence:QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRK IGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL PGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRV TNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGV CTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMAVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH 7.4.;Stability:Recombinant Human Connective Tissue Growth Factor/CTGF/CCN2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CTGF protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human CTGF protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human CTGF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;