Cat#:RPH-NP082;Product Name:Recombinant Human Complement Factor D / Adipsin (C-10His);Synonym:Complement factor D, CFD, Adipsin, C3 convertase activator, Properdin factor D, DF, PFD;Description:Recombinant Human Complement factor D Protein is produced in Human Cells and the target gene encoding Ile26-Ala253 is expressed with a 10His tag at the N-terminus.;Source:Human Cells;AA Sequence:ILGGREAEAHARPYMASVQLNGAHLCGGVLVAEQWVLSAAHCLEDAADGKVQVLLGAHSLSQPEP SKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGI VNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRRDSCKGDSGGPLVCGGVLEG VVTSGSRVCGNRKKPGIYTRVASYAAWIDSVLAHHHHHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Complement Factor D/Adipsin (C-10His)was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH7.5.;Stability:Recombinant Human Complement Factor D/Adipsin (C-10His)is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Adipsin protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Adipsin protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Adipsin protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Complement factor D Protein is produced in Human Cells and the target gene encoding Ile26-Ala253 is expressed with a 10His tag at the N-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Complement Factor D/Adipsin (C-10His)was lyophilized from a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, pH7.5.
Stability:
Recombinant Human Complement Factor D/Adipsin (C-10His)is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Adipsin protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Adipsin protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Adipsin protein samples are stable below -20°C for 3 months.