Cat#:RPH-NP081;Product Name:Recombinant Human Ciliary Neurotrophic Factor / CNTF Protein;Synonym:Ciliary Neurotrophic Factor, CNTF;Description:Recombinant Human CNTF Protein is produced in E.coli and the target gene encoding Ala2-Met200 is expressed.;Source:E.coli;AA Sequence:AFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSE LTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLE YKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIAN NKKM;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.;Stability:Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CNTF protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM Cysteine, pH 7.4.
Stability:
Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human Ciliary Neurotrophic Factor/CNTF Protein protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CNTF protein samples are stable below -20°C for 3 months.