Cat#:RPH-NP085;Product Name:Recombinant Human C-Reactive Protein / CRP Protein;Synonym:C-Reactive Protein, CRP, PTX1;Description:Recombinant Human CRP Protein is produced in E.coli and the target gene encoding Gln19-Pro224 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:MQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTELSSTRGYSIFSYATKRQDNEIL IFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWESASGIVEFWVDGKPRVRKSLKKGYTVGA EASIILGQEQDSFGGNFEGSQSLVGDIGNVNMWDFVLSPDEINTIYLGGPFSPNVLNWRALKYEV QGEVFTKPQLWPLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human C-Reactive Protein /CRP Protein was lyophilized from a 0.2 μm filtered solution of 20mMTris,2MUrea,pH8.0.;Stability:Recombinant Human C-Reactive Protein /CRP Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CRP protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human CRP protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human CRP protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human C-Reactive Protein /CRP Protein was lyophilized from a 0.2 μm filtered solution of 20mMTris,2MUrea,pH8.0.
Stability:
Recombinant Human C-Reactive Protein /CRP Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized recombinant human CRP protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted human CRP protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human CRP protein samples are stable below -20°C for 3 months.