Cat#:RPH-NP046;Product Name:Recombinant Human Carboxypeptidase A4 / CPA4 Protein;Synonym:Carboxypeptidase A4, Carboxypeptidase A3, CPA4, CPA3;Description:Recombinant Human Carboxypeptidase A4 Protein is produced in Human Cells and the target gene encoding Gly17-Tyr421 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:GQEKFFGDQVLRINVRNGDEISKLSQLVNSNNLKLNFWKSPSSFNRPVDVLVPSVSLQAFKSFLR SQGLEYAVTIEDLQALLDNEDDEMQHNEGQERSSNNFNYGAYHSLEAIYHEMDNIAADFPDLARR VKIGHSFENRPMYVLKFSTGKGVRRPAVWLNAGIHSREWISQATAIWTARKIVSDYQRDPAITSI LEKMDIFLLPVANPDGYVYTQTQNRLWRKTRSRNPGSSCIGADPNRNWNASFAGKGASDNPCSEV YHGPHANSEVEVKSVVDFIQKHGNFKGFIDLHSYSQLLMYPYGYSVKKAPDAEELDKVARLAAKA LASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELRDTGTYGFLLPANQIIPTAEETW LGLKTIMEHVRDNLYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase A4/CPA4 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5.;Stability:Recombinant Human Carboxypeptidase A4/CPA4 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase A4/CPA4 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase A4 Protein is produced in Human Cells and the target gene encoding Gly17-Tyr421 is expressed with a His tag at the C-terminus.