Cat#:RPH-NP047;Product Name:Recombinant Human Carboxypeptidase B / CPB1 Protein;Synonym:Carboxypeptidase B, Pancreas-Specific Protein, PASP, CPB1, CPB, PCPB;Description:Recombinant Human Carboxypeptidase B Protein is produced in Human Cells and the target gene encoding His16-Tyr417 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:HHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVE NVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVI GTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKL DFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGP AAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELAS LHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI KYVASYVLEHLYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase B/CPB1 Protein was supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.;Stability:Recombinant Human Carboxypeptidase B/CPB1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase B/CPB1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase B Protein is produced in Human Cells and the target gene encoding His16-Tyr417 is expressed with a His tag at the C-terminus.