Cat#:RPH-NP048;Product Name:Recombinant Human Carboxypeptidase B2 / CPB2 Protein;Synonym:Carboxypeptidase B2, Carboxypeptidase U, CPU, Plasma Carboxypeptidase B, pCPB, Thrombin-Activable Fibrinolysis Inhibitor, TAFI, CPB2;Description:Recombinant Human Carboxypeptidase B2 Protein is produced in Human Cells and the target gene encoding Phe23-Val423 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:FQSGQVLAALPRTSRQVQVLQNLTTTYEIVLWQPVTADLIVKKKQVHFFVNASDVDNVKAHLNVS GIPCSVLLADVEDLIQQQISNDTVSPRASASYYEQYHSLNEIYSWIEFITERHPDMLTKIHIGSS FEKYPLYVLKVSGKEQAAKNAIWIDCGIHAREWISPAFCLWFIGHITQFYGIIGQYTNLLRLVDF YVMPVVNVDGYDYSWKKNRMWRKNRSFYANNHCIGTDLNRNFASKHWCEEGASSSSCSETYCGLY PESEPEVKAVASFLRRNINQIKAYISMHSYSQHIVFPYSYTRSKSKDHEELSLVASEAVRAIEKT SKNTRYTHGHGSETLYLAPGGGDDWIYDLGIKYSFTIELRDTGTYGFLLPERYIKPTCREAFAAV SKIAWHVIRNVLDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase B2/CPB2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM ZnCl2,10%Glycerol,pH7.5.;Stability:Recombinant Human Carboxypeptidase B2/CPB2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase B2/CPB2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase B2 Protein is produced in Human Cells and the target gene encoding Phe23-Val423 is expressed with a His tag at the C-terminus.