Cat#:RPH-NP049;Product Name:Recombinant Human Carboxypeptidase E / CPE Protein;Synonym:Carboxypeptidase E(CPE for short), Carboxypeptidase H, Enkephalin convertase, Prohormone-processing carboxypeptidase;Description:Recombinant Human Carboxypeptidase E Protein is produced in Human Cells and the target gene encoding Arg42-Ser453 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:RLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPE FKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGE LKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWI MDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCR KNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLI SYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAI TKKVAVPYSPAAGVDFELESFSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase E/CPE Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM ZnCl2,10%Glycerol,pH7.5.;Stability:Recombinant Human Carboxypeptidase E/CPE Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase E/CPE Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase E / CPE Protein
Online Inquiry
Cat#:
RPH-NP049
Product Name:
Recombinant Human Carboxypeptidase E / CPE Protein
Synonym:
Carboxypeptidase E(CPE for short), Carboxypeptidase H, Enkephalin convertase, Prohormone-processing carboxypeptidase
Description:
Recombinant Human Carboxypeptidase E Protein is produced in Human Cells and the target gene encoding Arg42-Ser453 is expressed with a His tag at the C-terminus.