Cat#:RPH-NP050;Product Name:Recombinant Human Carboxypeptidase M / CPM Protein;Synonym:Carboxypeptidase M,CPM;Description:Recombinant Human Carboxypeptidase M Protein is produced in Human Cells and the target gene encoding Leu18-His422 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVLVVGRFPKEHRIGIPEFKYVANM HGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIHIMPSMNPDGFEAVKKPDCYYSIGRENY NQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKTETFVLSANLHGGALVASYPFDNGVQATGALYS RSLTPDDDVFQYLAHTYASRNPNMKKGDECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFE ITLELSCCKYPREEKLPSFWNNNKASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICP YRTNKYGEYYLLLLPGSYIINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSN PSCPMIPLYRNLPDHVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase M/CPM Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mM NaCl,1mM ZnCl2,pH7.5.;Stability:Recombinant Human Carboxypeptidase M/CPM Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase M/CPM Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase M / CPM Protein
Online Inquiry
Cat#:
RPH-NP050
Product Name:
Recombinant Human Carboxypeptidase M / CPM Protein
Synonym:
Carboxypeptidase M,CPM
Description:
Recombinant Human Carboxypeptidase M Protein is produced in Human Cells and the target gene encoding Leu18-His422 is expressed with a His tag at the C-terminus.