Cat#:RPH-NP045;Product Name:Recombinant Human Carboxypeptidase A2 / CPA2 Protein;Synonym:Carboxypeptidase A2, CPA2;Description:Recombinant Human Carboxypeptidase A2 Protein is produced in Human Cells and the target gene encoding Leu17-Tyr417 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTTPGETAHVRVPFVNVQAVKVFLGS QGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNFGAYHTLEEISQEMDNLVAEHPGLVSKVN IGSSFENRPMNVLKFSTGGDKPAIWLDAGIHAREWVTQATALWTANKIVSDYGKDPSITSILDAL DIFLLPVTNPDGYVFSQTKNRMWRKTRSKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGP SANSEVEVKSIVDFIKSHGKVKAFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSL HGTKYKVGPICSVIYQASGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLK AIMEHVRDHPYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase A2/CPA2 Protein was lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5.;Stability:Recombinant Human Carboxypeptidase A2/CPA2 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Carboxypeptidase A2/CPA2 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CPA2 protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted recombinant human CPA2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;