Cat#:RPH-NP044;Product Name:Recombinant Human Carboxypeptidase A1 / CPA1 Protein;Synonym:Carboxypeptidase A1, CPA1, CPA;Description:Recombinant Human Carboxypeptidase A1 Protein is produced in Human Cells and the target gene encoding Lys17-Tyr419 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:KEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLES HGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKI QIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILD TLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYR GKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALA SLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLA LLTIMEHTLNHPYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Carboxypeptidase A1/CPA1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5.;Stability:Recombinant Human Carboxypeptidase A1/CPA1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Carboxypeptidase A1/CPA1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Carboxypeptidase A1 / CPA1 Protein
Online Inquiry
Cat#:
RPH-NP044
Product Name:
Recombinant Human Carboxypeptidase A1 / CPA1 Protein
Synonym:
Carboxypeptidase A1, CPA1, CPA
Description:
Recombinant Human Carboxypeptidase A1 Protein is produced in Human Cells and the target gene encoding Lys17-Tyr419 is expressed with a His tag at the C-terminus.