• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Carboxypeptidase A1 / CPA1 Protein Online Inquiry

  • Cat#:
  • RPH-NP044
  • Product Name:
  • Recombinant Human Carboxypeptidase A1 / CPA1 Protein
  • Synonym:
  • Carboxypeptidase A1, CPA1, CPA
  • Description:
  • Recombinant Human Carboxypeptidase A1 Protein is produced in Human Cells and the target gene encoding Lys17-Tyr419 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • KEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQAVKIFLES HGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYATYHTLEEIYDFLDLLVAENPHLVSKI QIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILD TLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYR GKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALA SLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLA LLTIMEHTLNHPYVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Carboxypeptidase A1/CPA1 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mm NaCl, pH 7.5.
  • Stability:
  • Recombinant Human Carboxypeptidase A1/CPA1 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human Carboxypeptidase A1/CPA1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human CES1 Protein I Advanced Biomart
  • Online Inquiry

    refresh