Cat#:RPH-NP078;Product Name:Recombinant Human CD44 / MIC4 Protein;Synonym:CD44 Antigen, CDw44, Epican, Extracellular Matrix Receptor III, ECMR-III, GP90 Lymphocyte Homing/Adhesion Receptor, HUTCH-I, Heparan Sulfate Proteoglycan, Hermes Antigen, Hyaluronate Receptor, Phagocytic Glycoprotein 1, PGP-1, Phagocytic Glycoprotein I, PGP-I, CD44, LHR, MDU2, MDU3, MIC4;Description:Recombinant Human CD44 Protein is produced in Human Cells and the target gene encoding Gln21-Pro220 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGH VVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDS TDRIPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD44/MIC4 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.;Stability:Recombinant Human CD44/MIC4 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD44 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD44 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD44 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;