Cat#:RPH-NP079;Product Name:Recombinant Human CD47 / IAP / OA3 Protein;Synonym:Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-Associated Protein, IAP, Protein MER6, CD47, MER6;Description:Recombinant Human CD47 Protein is produced in Human Cells and the target gene encoding Gln19-Pro139 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSS AKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD47/IAP/OA3 Protein was lyophilized from a 0.2 μm filtered solution of 10mM Tris-Citrate, 150mM NaCl, pH 8.0.;Stability:Recombinant Human CD47/IAP/OA3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD47 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD47 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD47 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;