Cat#:RPH-NP077;Product Name:Recombinant Human CD40 / TNFRSF5 / CD40L Receptor Protein;Synonym:Tumor Necrosis Factor Receptor Superfamily member 5, B-Cell Surface Antigen CD40, Bp50, CD40L Receptor, CDw40, CD40, TNFRSF5;Description:Recombinant Human TNFRSF5 Protein is produced in Human Cells and the target gene encoding Glu21-Arg193 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:EPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDP NLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGF FSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human CD40/TNFRSF5/CD40L Receptor Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human CD40/TNFRSF5/CD40L Receptor Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant human CD40 protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human CD40 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human CD40 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;