Cat#:RPH-NP037;Product Name:Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog / BAMBI Protein;Synonym:BMP and Activin Membrane-Bound Inhibitor Homolog, Non-Metastatic Gene A Protein, Putative Transmembrane Protein NMA, BAMBI, NMA;Description:Recombinant Human BAMBI Protein is produced in Human Cells and the target gene encoding Val21-Ala152 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQA RNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWF RAVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.;Stability:Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human BAMBI Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted Recombinant Human BAMBI Protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human BAMBI Protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;