Cat#:RPH-NP038;Product Name:Recombinant Human BMP Receptor IA / ALK-3 / CD292 Protein;Synonym:Bone Morphogenetic Protein Receptor Type-1A, BMP Type-1A Receptor, BMPR-1A, Activin Receptor-Like Kinase 3, ALK-3, Serine/Threonine-Protein Kinase Receptor R5, SKR5, CD292, BMPR1A, ACVRLK3, ALK3;Description:Recombinant Human BMP receptor IA Protein is produced in Human Cells and the target gene encoding Gln24-Arg152 is expressed with a Fc, His tag at the C-terminus.;Source:Human Cells;AA Sequence:QNLDSMLHGTGMKSDSDQKKSENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEE DDQGETTLASGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRV DDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE VKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDG SFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human BMP Receptor IA/ALK-3/CD292 Protein was lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4.;Stability:Recombinant Human BMP Receptor IA/ALK-3/CD292 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized recombinant ALK-3 protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted recombinant ALK-3 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted human ALK-3 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;