Cat#:RPH-NP036;Product Name:Recombinant Human Biliverdin Reductase A / BVR A Protein;Synonym:BLVRA,Biliverdin reductase A,BVR A,Biliverdin-IX alpha-reductase,BLVR,BVR, REF: C1004;Description:Recombinant Human Biliverdin reductase A Protein is produced in E.coli and the target gene encoding Glu6-Ser294 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:MERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVE VAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVSHEEHVELLMEEFA FLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYM KMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLG QFSEKELAAEKKRILHCLGLAEEIQKYCCSLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Biliverdin Reductase A/BVR A Protein was lyophilized from a 0.2 μm filtered solution of 4mM HCl.;Stability:Recombinant Human Biliverdin Reductase A/BVR A Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Biliverdin Reductase A/BLVRA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted Recombinant Human BLVRA protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human BLVRA protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Biliverdin reductase A Protein is produced in E.coli and the target gene encoding Glu6-Ser294 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Biliverdin Reductase A/BVR A Protein was lyophilized from a 0.2 μm filtered solution of 4mM HCl.
Stability:
Recombinant Human Biliverdin Reductase A/BVR A Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Biliverdin Reductase A/BLVRA protein should be stored below -20°C, though stable at room temperature for 3 weeks. Reconstituted Recombinant Human BLVRA protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted Recombinant Human BLVRA protein samples are stable below -20°C for 3 months.