Cat#:RPH-NP027;Product Name:Recombinant Human Angiotensinogen / Serpin A8 / AGT Protein;Synonym:Angiotensinogen, also called Serpin A8, AGT and SERPINA8, is expressed by the liver and secreted in plasma. Angiotensinogen is a member of the serpin family.;Description:Recombinant Human Serpin A8/Angiotensinogen Protein is produced in Human Cells and the target gene encoding Asp34-Ala485 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:DRVYIHPFHLVIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTE DKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILG VPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLA LYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLTGASVDSTLAFNTYVHFQGKMKGFSL LAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVSFTESACLLLIQPHYASDLDKVEG LTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGE VLNSIFFELEADEREPTESTQQLNKPEVLEVTLNRPFLFAVYDQSATALHFLGRVANPLSTAVDH HHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Angiotensinogen/Serpin A8/AGT Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Angiotensinogen/Serpin A8/AGT Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Serpin A8/AGT Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;