Cat#:RPH-NP026;Product Name:Recombinant Human Angiotensin-Converting Enzyme 2 / ACE-2 Protein;Synonym:Angiotensin-Converting Enzyme 2, ACE-Related Carboxypeptidase, Angiotensin-Converting Enzyme Homolog, ACEH, Metalloprotease MPROT15, ACE2;Description:Recombinant Human Angiotensin-Converting Enzyme 2 Protein is produced in Human Cells and the target gene encoding Gln18-Ser740 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:QSTIEEQAKTFLDKFNHEAEDLFYQSSLASWNYNTNITEENVQNMNNAGDKWSAFLKEQSTLAQM YPLQEIQNLTVKLQLQALQQNGSSVLSEDKSKRLNTILNTMSTIYSTGKVCNPDNPQECLLLEPG LNEIMANSLDYNERLWAWESWRSEVGKQLRPLYEEYVVLKNEMARANHYEDYGDYWRGDYEVNGV DGYDYSRGQLIEDVEHTFEEIKPLYEHLHAYVRAKLMNAYPSYISPIGCLPAHLLGDMWGRFWTN LYSLTVPFGQKPNIDVTDAMVDQAWDAQRIFKEAEKFFVSVGLPNMTQGFWENSMLTDPGNVQKA VCHPTAWDLGKGDFRILMCTKVTMDDFLTAHHEMGHIQYDMAYAAQPFLLRNGANEGFHEAVGEI MSLSAATPKHLKSIGLLSPDFQEDNETEINFLLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKDQ WMKKWWEMKREIVGVVEPVPHDETYCDPASLFHVSNDYSFIRYYTRTLYQFQFQEALCQAAKHEG PLHKCDISNSTEAGQKLFNMLRLGKSEPWTLALENVVGAKNMNVRPLLNYFEPLFTWLKDQNKNS FVGWSTDWSPYADQSIKVRISLKSALGDKAYEWNDNEMYLFRSSVAYAMRQYFLKVKNQMILFGE EDVRVANLKPRISFNFFVTAPKNVSDIIPRTEVEKAIRMSRSRINDAFRLNDNSLEFLGIQPTLG PPNQPPVSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:Specific Activity is greater than 800 pmol/min/μg.;Formulation:Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.1mM ZnCl2, 10% Glycerol, pH 7.5.;Stability:Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human ACE-2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Angiotensin-Converting Enzyme 2 Protein is produced in Human Cells and the target gene encoding Gln18-Ser740 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
Specific Activity is greater than 800 pmol/min/μg.
Formulation:
Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, 0.1mM ZnCl2, 10% Glycerol, pH 7.5.
Stability:
Recombinant Human Angiotensin-Converting Enzyme 2/ACE-2 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human ACE-2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.