Cat#:RPH-NP028;Product Name:Recombinant Human Arginase-1 / ARG1 Protein;Synonym:Arginase-1, Liver-type arginase,Type I arginase,ARG1;Description:Recombinant Human Arginase-1 Protein is produced in E.coli and the target gene encoding Met1-lys322 is expressed with a His tag at the C-terminus.;Source:E. coli;AA Sequence:MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQ IVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDIN TPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGI KYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYI TEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLEH HHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Arginase-1/ARG1 Protein was supplied as a 0.2 μm filtered solution of 20mM Tris, 150mM NaCl, 20% Glycerol, 1mM DTT, pH 7.4.;Stability:Recombinant Human Arginase-1/ARG1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human ARG1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;