Cat#:RPH-NP147;Product Name:Recombinant Human Fructose-Bisphosphate Aldolase A / ALDOA Protein;Synonym:Fructose-Bisphosphate Aldolase A, Lung Cancer Antigen NY-LU-1, Muscle-Type Aldolase, ALDOA, ALDA;Description:Recombinant Human Fructose-Bisphosphate Aldolase A Protein is produced in E.coli and the target gene encoding Pro2-Tyr364 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:PYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTA DDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGETTTQGLDGL SERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQNGIVPIVEPEILPDGD HDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHACTQKFSHEEIAMATVTALRRTV PPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTFSYGRALQASALKAWGGKKENLKAAQE EYVKRALANSLACQGKYTPSGQAGAAASESLFVSNHAYLEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 20% Glycerol, pH 8.0.;Stability:Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Fructose-Bisphosphate Aldolase A / ALDOA Protein
Online Inquiry
Cat#:
RPH-NP147
Product Name:
Recombinant Human Fructose-Bisphosphate Aldolase A / ALDOA Protein
Synonym:
Fructose-Bisphosphate Aldolase A, Lung Cancer Antigen NY-LU-1, Muscle-Type Aldolase, ALDOA, ALDA
Description:
Recombinant Human Fructose-Bisphosphate Aldolase A Protein is produced in E.coli and the target gene encoding Pro2-Tyr364 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 20% Glycerol, pH 8.0.
Stability:
Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Fructose-Bisphosphate Aldolase A/ALDOA Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.