Cat#:RPH-NP146;Product Name:Recombinant Human Fructose-2,6-Bisphosphatase 1 / PFKFB1 / PFK / FBPase 1 Protein;Synonym:6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1, 6PF-2-K/Fru-2,6-P2ase liver isozyme, Fructose-2,6-bisphosphatase, PFKFB1, F6PK, PFRX;Description:Recombinant Human FBPase 1 Protein is produced in Human Cells and the target gene encoding Ser2-Tyr471 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:SPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYISTKLTRYL NWIGTPTKVFNLGQYRREAVSYKNYEFFLPDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFD ATNTTRERRSLILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKR IECYEVNYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGE SELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQWKAL NEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMELERQENVLVI CHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVEAVNTHREKPENVDI TREPEEALDTVPAHYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein was supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Stability:
Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Fructose-2,6-Bisphosphatase 1/PFKFB1/PFK/FBPase 1 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.