Cat#:RPH-NP148;Product Name:Recombinant Human Fructose-Bisphosphate Aldolase C / ALDOC Protein;Synonym:Fructose-bisphosphate aldolase C,Brain-type aldolase, ALDC, Aldo3, Aldolase C, Scrg2, zebrin II;Description:Recombinant Human Fructose-Bisphosphate Aldolase C Protein is produced in Human Cells and the target gene encoding Phe2-Tyr364 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:PHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSA DDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGL SERCAQYKKDGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGD HDLKRCQYVTEKVLAAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTV PPAVPGVTFLSGGQSEEEASFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATE EFIKRAEVNGLAAQGKYEGSGEDGGAAAQSLYIANHAYVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,100mM NaCl,pH8.0.;Stability:Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Fructose-Bisphosphate Aldolase C Protein is produced in Human Cells and the target gene encoding Phe2-Tyr364 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl,100mM NaCl,pH8.0.
Stability:
Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Fructose-Bisphosphate Aldolase C/ALDOC Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.