Cat#:RPH-NP021;Product Name:Recombinant Human Aldo-Keto Reductase 1C4 / AKR1C4 Protein;Synonym:Aldo-Keto Reductase Family 1 Member C4, 3-Alpha-HSD1, 3-Alpha-Hydroxysteroid Dehydrogenase Type I, Chlordecone Reductase, CDR, Dihydrodiol Dehydrogenase 4, DD-4, DD4, HAKRA, AKR1C4, CHDR;Description:Recombinant Human Aldo-Keto Reductase 1C4 Protein is produced in E.coli and the target gene encoding Met1-Tyr323 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMDPKYQRVELNDGHFMPVLGFGTYAPPEVPRNRAVEVTKLAIEAG FRHIDSAYLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCTFFQPQMVQPALESSLKKLQLDY VDLYLLHFPMALKPGETPLPKDENGKVIFDTVDLSATWEVMEKCKDAGLAKSIGVSNFNYRQLEM ILNKPGLKYKPVCNQVECHPYLNQSKLLDFCKSKDIVLVAHSALGTQRHKLWVDPNSPVLLEDPV LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRENIQVFEFQLTSEDMKVLDGLNRNYRY VVMDFLMDHPDYPFSDEY;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Aldo-Keto Reductase 1C4/AKR1C4 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 150mM NaCl, pH 8.0.;Stability:Recombinant Human Aldo-Keto Reductase 1C4/AKR1C4 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human AKR1C4 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;