Cat#:RPH-NP020;Product Name:Recombinant Human Aldo-Keto Reductase 1C3 / AKR1C3 Protein;Synonym:Aldo-Keto Reductase Family 1 Member C3, 17-Beta-Hydroxysteroid Dehydrogenase Type 5, 17-Beta-HSD 5, 3-Alpha-HSD Type II Brain, 3-Alpha-Hydroxysteroid Dehydrogenase Type 2, 3-Alpha-HSD Type 2, Chlordecone Reductase Homolog HAKRb, Dihydrodiol Dehydrogenase 3, DD-3, DD3, Dihydrodiol Dehydrogenase Type I, HA1753, Indanol Dehydrogenase, Prostaglandin F Synthase, Testosterone 17-Beta-Dehydrogenase 5, Trans-1,2-Dihydrobenzene-1,2-Diol Dehydrogenase, AKR1C3, DDH1, HSD17B5, KIAA0119, PGFS;Description:Recombinant Human Aldo-Keto Reductase 1C3 Protein is produced in Human Cells and the target gene encoding Met1-Tyr323 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAI RSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSP TDENGKVIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHP YFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEYVD HHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Aldo-Keto Reductase 1C3/AKR1C3 Protein was lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.;Stability:Recombinant Human Aldo-Keto Reductase 1C3/AKR1C3 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human AKR1C2 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human AKR1C2 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human AKR1C2 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;