Cat#:RPH-NP019;Product Name:Recombinant Human Aldo-Keto Reductase 1C2 / AKR1C2 Protein;Synonym:Aldo-Keto Reductase Family 1 Member C2, 3-Alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-Binding Protein, DD/BABP, Trans-1,2-Dihydrobenzene-1,2-Diol Dehydrogenase, Type III 3-Alpha-Hydroxysteroid Dehydrogenase, AKR1C2, DDH2;Description:Recombinant Human Aldo-Keto Reductase 1C3 Protein is produced in E.coli and the target gene encoding Met1-Tyr323 is expressed.;Source:E.coli;AA Sequence:MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAI RSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIP KDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHP YFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.;Stability:Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2 Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store recombinant human AKR1C2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;