• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Aldo-Keto Reductase 1C2 / AKR1C2 Protein Online Inquiry

  • Cat#:
  • RPH-NP019
  • Product Name:
  • Recombinant Human Aldo-Keto Reductase 1C2 / AKR1C2 Protein
  • Synonym:
  • Aldo-Keto Reductase Family 1 Member C2, 3-Alpha-HSD3, Chlordecone Reductase Homolog HAKRD, Dihydrodiol Dehydrogenase 2, DD-2, DD2, Dihydrodiol Dehydrogenase/Bile Acid-Binding Protein, DD/BABP, Trans-1,2-Dihydrobenzene-1,2-Diol Dehydrogenase, Type III 3-Alpha-Hydroxysteroid Dehydrogenase, AKR1C2, DDH2
  • Description:
  • Recombinant Human Aldo-Keto Reductase 1C3 Protein is produced in E.coli and the target gene encoding Met1-Tyr323 is expressed.
  • Source:
  • E.coli
  • AA Sequence:
  • MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEAVKLAIEAGFHHIDSAHVYNNEEQVGLAI RSKIADGSVKREDIFYTSKLWSNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIP KDENGKILFDTVDLCATWEAMEKCKDAGLAKSIGVSNFNHRLLEMILNKPGLKYKPVCNQVECHP YFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQ LQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2 Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 1mM DTT, pH 8.0.
  • Stability:
  • Recombinant Human Aldo-Keto Reductase 1C2/AKR1C2 Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store recombinant human AKR1C2 Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human ALDH3A1 Protein I Advanced Biomart
  • Online Inquiry

    refresh