Cat#:RPH-NP018;Product Name:Recombinant Human Aldehyde Dehydrogenase 3-A1 / ALDH3A1 Protein;Synonym:Aldehyde dehydrogenase, dimeric NADP-preferring,,ALDH3,ALDH3A1,Aldehyde dehydrogenase family 3 member A1,Aldehyde dehydrogenase 3,ALDHIII,ALDH3A1;Description:Recombinant Human Aldehyde Dehydrogenase 3-A1 Protein is produced in Human Cells and the target gene encoding Met1-His453 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVV YVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIA AGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKERFDHILYTGSTGVGKI IMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNSGQTCVAPDYILCDPSIQNQI VEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEGQKVAYGGTGDAATRYIAPTILTDVD PQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLALYMFSSNDKVIKKMIAETSSGGVAAND VIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQHVD HHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.;Stability:Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein is stable for up to 1 year from date of receipt at -70℃.;Reconstitution:Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.;Storage:Lyophilized Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human ALDH3A1 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human ALDH3A1 protein samples are stable below -20°C for 3 months.;Usage:For Lab Research Use Only;
Recombinant Human Aldehyde Dehydrogenase 3-A1 / ALDH3A1 Protein
Online Inquiry
Cat#:
RPH-NP018
Product Name:
Recombinant Human Aldehyde Dehydrogenase 3-A1 / ALDH3A1 Protein
Synonym:
Aldehyde dehydrogenase, dimeric NADP-preferring,,ALDH3,ALDH3A1,Aldehyde dehydrogenase family 3 member A1,Aldehyde dehydrogenase 3,ALDHIII,ALDH3A1
Description:
Recombinant Human Aldehyde Dehydrogenase 3-A1 Protein is produced in Human Cells and the target gene encoding Met1-His453 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Formulation:
Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein was lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Stability:
Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein is stable for up to 1 year from date of receipt at -70℃.
Reconstitution:
Please centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Usage:
For Lab Research Use Only
Storage:
Lyophilized Recombinant Human Aldehyde Dehydrogenase 3-A1/ALDH3A1 Protein should be stored below -20°C, though stable at room temperature for 3 weeks.Reconstituted recombinant human ALDH3A1 protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted recombinant human ALDH3A1 protein samples are stable below -20°C for 3 months.