Cat#:RPH-NP022;Product Name:Recombinant Human Alkaline Phosphatase / ALPL Protein;Synonym:Alkaline Phosphatase, Tissue-Nonspecific Isozyme, AP-TNAP, TNSALP, Alkaline Phosphatase Liver/Bone/Kidney Isozyme, ALPL;Description:Recombinant Human Alkaline Phosphatase Protein is produced in Human Cells and the target gene encoding Leu18-Ser502 is expressed with a His tag at the C-terminus.;Source:Human Cells;AA Sequence:LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPG EETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEV TSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNI RDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLT LDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHE GKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDK KPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLH GVHEQNYVPHVMAYAACIGANLGHCAPASSVDHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Bioactivity:Special Activity: 66 U/mg based on useing p-nitrophenyl phosphate (pNPP) as a phosphatase substrate which turns yellow (λmax= 405 nm) when dephosphorylated by ALP. At pH10.4, 37⁰C, 1 Unit is defined as cleaving 1.0 µmol p-nitrophenyl phosphate (pNPP) per minute.;Formulation:Recombinant Human Alkaline Phosphatase/ALPL Protein was supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM MgSO4, 0.1mM ZnCl2, pH 7.5.;Stability:Recombinant Human Alkaline Phosphatase/ALPL Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant Human Alkaline Phosphatase/ALPL Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant Human Alkaline Phosphatase Protein is produced in Human Cells and the target gene encoding Leu18-Ser502 is expressed with a His tag at the C-terminus.
Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin:
< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Bioactivity:
Special Activity: 66 U/mg based on useing p-nitrophenyl phosphate (pNPP) as a phosphatase substrate which turns yellow (λmax= 405 nm) when dephosphorylated by ALP. At pH10.4, 37⁰C, 1 Unit is defined as cleaving 1.0 µmol p-nitrophenyl phosphate (pNPP) per minute.
Formulation:
Recombinant Human Alkaline Phosphatase/ALPL Protein was supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM MgSO4, 0.1mM ZnCl2, pH 7.5.
Stability:
Recombinant Human Alkaline Phosphatase/ALPL Protein is stable for up to 1 year from date of receipt at -70℃.
Usage:
For Lab Research Use Only
Storage:
Store Recombinant Human Alkaline Phosphatase/ALPL Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.