• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant Human Alkaline Phosphatase / ALPL Protein Online Inquiry

  • Cat#:
  • RPH-NP022
  • Product Name:
  • Recombinant Human Alkaline Phosphatase / ALPL Protein
  • Synonym:
  • Alkaline Phosphatase, Tissue-Nonspecific Isozyme, AP-TNAP, TNSALP, Alkaline Phosphatase Liver/Bone/Kidney Isozyme, ALPL
  • Description:
  • Recombinant Human Alkaline Phosphatase Protein is produced in Human Cells and the target gene encoding Leu18-Ser502 is expressed with a His tag at the C-terminus.
  • Source:
  • Human Cells
  • AA Sequence:
  • LVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPG EETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEV TSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNI RDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLT LDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHE GKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDK KPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLH GVHEQNYVPHVMAYAACIGANLGHCAPASSVDHHHHHH
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Bioactivity:
  • Special Activity: 66 U/mg based on useing p-nitrophenyl phosphate (pNPP) as a phosphatase substrate which turns yellow (λmax= 405 nm) when dephosphorylated by ALP. At pH10.4, 37⁰C, 1 Unit is defined as cleaving 1.0 µmol p-nitrophenyl phosphate (pNPP) per minute.
  • Formulation:
  • Recombinant Human Alkaline Phosphatase/ALPL Protein was supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 2mM MgSO4, 0.1mM ZnCl2, pH 7.5.
  • Stability:
  • Recombinant Human Alkaline Phosphatase/ALPL Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant Human Alkaline Phosphatase/ALPL Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human AKR1C4 Protein I Advanced Biomart
  • Online Inquiry

    refresh