Cat#:RPH-NP001;Product Name:Recombinant E. coli Malate Dehydrogenase / MDH Protein;Synonym:Malate dehydrogenase,mdh;Description:Recombinant E.coli Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Lys312 is expressed with a His tag at the N-terminus.;Source:E.coli;AA Sequence:MGSSHHHHHHSSGLVPRGSHMKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD LSHIPTAVKIKGFSGEDATPALEGADVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCP KACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSNTFVAELKGKQPGEVEVPVIG GHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVR ALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIAL GQEFVNK;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant E. coli Malate Dehydrogenase/MDH Protein was supplied as a 0.2 μm filtered solution of 50mM PB,50%Glycerol,pH7.5.;Stability:Recombinant E. coli Malate Dehydrogenase/MDH Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant E. coli Malate Dehydrogenase/MDH Protei below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;
Recombinant E. coli Malate Dehydrogenase / MDH Protein
Online Inquiry
Cat#:
RPH-NP001
Product Name:
Recombinant E. coli Malate Dehydrogenase / MDH Protein
Synonym:
Malate dehydrogenase,mdh
Description:
Recombinant E.coli Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Lys312 is expressed with a His tag at the N-terminus.