• Tel:1-862-686-3631
  • Fax: 1-323-978-5598
Home > Products > Recombinant Proteins > Human Proteins >

Recombinant E. coli Malate Dehydrogenase / MDH Protein Online Inquiry

  • Cat#:
  • RPH-NP001
  • Product Name:
  • Recombinant E. coli Malate Dehydrogenase / MDH Protein
  • Synonym:
  • Malate dehydrogenase,mdh
  • Description:
  • Recombinant E.coli Malate Dehydrogenase Protein is produced in E.coli and the target gene encoding Met1-Lys312 is expressed with a His tag at the N-terminus.
  • Source:
  • E.coli
  • AA Sequence:
  • MGSSHHHHHHSSGLVPRGSHMKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD LSHIPTAVKIKGFSGEDATPALEGADVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCP KACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSNTFVAELKGKQPGEVEVPVIG GHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVR ALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIAL GQEFVNK
  • Purity:
  • Greater than 95% as determined by reducing SDS-PAGE.
  • Endotoxin:
  • < 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
  • Formulation:
  • Recombinant E. coli Malate Dehydrogenase/MDH Protein was supplied as a 0.2 μm filtered solution of 50mM PB,50%Glycerol,pH7.5.
  • Stability:
  • Recombinant E. coli Malate Dehydrogenase/MDH Protein is stable for up to 1 year from date of receipt at -70℃.
  • Usage:
  • For Lab Research Use Only
  • Storage:
  • Store Recombinant E. coli Malate Dehydrogenase/MDH Protei below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.
  • Pre product:Recombinant Human TIM4 / TIMD4 Protein(His Tag)-Advanced Biomart
  • Online Inquiry

    refresh