Cat#:RPH-NP002;Product Name:Recombinant E. coli Methionine Aminopeptidase / MetAP / MAP Protein;Synonym:Methionine Aminopeptidase, MAP, Peptidase M, map;Description:Recombinant E.coli Methionine Aminopeptidase Protein is produced in E.coli and the target gene encoding Ala2-Glu264 is expressed with a His tag at the C-terminus.;Source:E.coli;AA Sequence:AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYP KSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQE SLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLK PGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS HDELEHHHHHH;Purity:Greater than 95% as determined by reducing SDS-PAGE.;Endotoxin:< 0.1 ng/µg (1 IEU/µg) as determined by LAL test.;Formulation:Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP Protein was supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.;Stability:Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP Protein is stable for up to 1 year from date of receipt at -70℃.;Storage:Store Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP Protein below -20°C, stable for 6 months after receipt. Please avoid repeated freeze-thaw cycles.;Usage:For Lab Research Use Only;